Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhbFGF | GE02.1 | 50μg | 24 months | 1000 |
GE02.2 | 100μg | 1800 |
Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE rhbFGF | GE02.1 | 50μg | 24 months | 1000 |
GE02.2 | 100μg | 1800 |
bFGF is a growth factor and signaling protein encoded by the FGF2 gene. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. In normal tissue, bFGF is present in basement membranes and in the subendothelial extracellular matrix of blood vessels. bFGF is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells.
Storage Class Code | WGK | Flash Point(F) |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
Flash Point(C) | Personal Protection | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 2247 |
AA Sequence | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Host | E.Coli |
Molecule Weight | Approximately 16.5 kDa, 146 amino acids |
Biological Activity | Fully biologically active when compared to standard substance. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 0.05 ng/mL, corresponding to a specific activity of > 2.0 × 107 IU/mg |
Purity | >96% by SDS-PAGE or HPLC |
Formulation | Lyophilized from 20mM Tris, 150mM NaCl, 5% trehalose, 0.2‰ TWEEN-20, pH7.6 |
Host Cell DNA | < 0.02 ng/μg of protein |
Host Cell Protein | < 0.05% when tested by ELISA |
Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Stability&Storage |
For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. At least 24 months from date of receipt, ≤-20℃ as supplied; 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution; 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
Description |
bFGF is a growth factor and signaling protein encoded by the FGF2 gene. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. In normal tissue, bFGF is present in basement membranes and in the subendothelial extracellular matrix of blood vessels. bFGF is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. |
Data |