Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
PDGF-BB | GE01.1 | 50μg | 24 months | 3000 |
GE01.2 | 100μg | 5100 |
Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE PDGF-BB | GE01.1 | 50μg | 24 months | 3000 |
GE01.2 | 100μg | 5100 |
Platelet-derived growth factors (PDGFs) are dimeric glycoprotein consisting of two 12.0-13.5 kDa polypeptide chains-chain A and chain B. The three naturally occurring subforms, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogen for cells of mesenchymal origin, including fibroblasts, smooth muscle cells and glial cells. PDGF is involved in various biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. PDGFs signal through two receptors, PDGFR-α and PDGFR-β.
Storage Class Code | WGK | Flash Point(F) |
11 - Combustible Solids | WGK 1 | Not Applicable |
Flash Point(C) | Personal Protection | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 5155 |
AA Sequence | MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Host | E.Coli |
Molecule Weight | 4.3 kDa disulfide-linked homodimer of 2 β-chains, the β-chain is a single non-glycosylated polypeptide chain containing 110 amino acids. |
Biological Activity | Fully biologically active when compared to standard substance. Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The biological activity>3.3×105 IU/mg protein. |
Purity | >97% by SDS-PAGE or HPLC |
Formulation | Lyophilized from a 0.2μm filtered solution in PBS pH 7.4. |
Host Cell DNA | < 0.02 ng/μg of protein |
Host Cell Protein | < 0.05% when tested by ELISA |
Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Stability&Storage |
For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. At least 24 months from date of receipt, ≤-20℃ as supplied; 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution; 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
Description |
Platelet-derived growth factors (PDGFs) are dimeric glycoprotein consisting of two 12.0-13.5 kDa polypeptide chains-chain A and chain B. The three naturally occurring subforms, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogen for cells of mesenchymal origin, including fibroblasts, smooth muscle cells and glial cells. PDGF is involved in various biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. PDGFs signal through two receptors, PDGFR-α and PDGFR-β. |
Data |