| Product | Catalog No. | Specification | Shelf life | Price |
|---|---|---|---|---|
BETAGENE rhIL-4 | GE20.1 | 20μg | 24 months | 2000 |
GE20.2 | 100μg | 5000 |
| Product | CAT. No. | Volumn | Shelf life | Price |
|---|---|---|---|---|
rhIL-4 | GE20.1 | 20μg | 24 months | 2000 |
GE20.2 | 100μg | 5000 |
Interleukin-4 (IL-4) is a pleiotropic cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells and produced by mast cells, activated T cells and bone marrow stromal cells. It has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. It enhances both secretion and cell surface expression of IgE and IgG1 and also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. The human IL-4 has a compact, globular fold, stabilised by 3 disulphide bonds. The human IL-4 shares about 40 % a.a. sequence identity with mouse/rat IL-4 and they are species-specific in their activities.
储存分类代码 | WGK | 闪点（F） |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
闪点（C) | 个人防护装备 | |
Not Applicable | dust mask type N95 (US), Eyeshields, Gloves | |
Specs
DATA
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 3565 |
AA Sequence | HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPV |
| Host | E.Coli |
Molecule Weight | Approximately 15.0 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids. |
Biological Activity | The ED50 as determined by a cell proliferation assay using human TF-1 cells is ＜0.2 ng/mL, corresponding to a specific activity of > 5.0 × 106 Units/mg. |
| Purity | ＞98% by SDS-PAGE or HPLC |
| Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Host Cell DNA | < 0.02 ng/μg of protein |
| Host Cell Protein | < 0.05% when tested by ELISA |
| Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
| Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Stability&Storage | For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. 12 months from date of receipt, -20 to -70 °C as supplied. 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL |
| Description |
IL-4 is a pleiotropic cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells and produced by mast cells, activated T cells and bone marrow stromal cells. It has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. It enhances both secretion and cell surface expression of IgE and IgG1 and also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. The human IL-4 has a compact, globular fold, stabilised by 3 disulphide bonds. The human IL-4 shares about 40 % a.a. sequence identity with mouse/rat IL-4 and they are species-specific in their activities. |
| Data |
|