| Product | Catalog No. | Specification | Shelf life | Price |
|---|---|---|---|---|
BETAGENE rhIL-1β | GE26.1 | 10μg | 24 months | 2000 |
GE26.2 | 100μg | 9000 |
| Product | CAT. No. | Volumn | Shelf life | Price |
|---|---|---|---|---|
rhIL-1β | GE26.1 | 10μg | 24 months | 2000 |
GE26.2 | 100μg | 9000 |
Interleukin-1 beta (IL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine.The human IL-1β cDNA encodes a 269 aa precursor.
储存分类代码 | WGK | 闪点（F） |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
闪点（C) | 个人防护装备 | |
Not Applicable | dust mask type N95 (US), Eyeshields, Gloves | |
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder
Gene ID
Catalog Number
GE20.1/GE20.2
Unit Size
10μg/100μg
Source
E. coli
Molecular Weight
Approximately 15.0 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids.
Purity (HPLC)
＞98%
Purity (SDS-PAGE)
＞98%
Biological Activity
The ED50 as determined by a cell proliferation assay using human TF-1 cells is ＜0.2 ng/mL, corresponding to a specific activity of > 5.0 × 106 Units/mg.
Host Cell DNA Residue
＜0.02 ng/μg of protein tested by DNA Fluorescent Staining method
Host Cell Protein Residue
＜0.5 ng/μg of protein tested by ELISA
Formulation
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Sterility
Negative
Endotoxin
＜0.01 EU/μg as determined by LAL gel-clot method
Mycoplasma
Negative
Shipping
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL
Reconstitution Stability & Storage
Please read our USER MANUAL and FAQs
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 3553 |
AA Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Host | E.Coli |
Molecule Weight | Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
Biological Activity | The ED50 determined by a cell proliferation assay using murine D10S cells is ＜0.001 ng/mL, corresponding to a specific activity of ≥ 1.0 × 109 IU/mg. |
| Purity | ＞98% by SDS-PAGE or HPLC |
| Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4 |
| Host Cell DNA | < 0.02 ng/μg of protein |
| Host Cell Protein | < 0.05% when tested by ELISA |
| Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
| Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Stability&Storage | For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. 12 months from date of receipt, -20 to -70 °C as supplied. 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
| Description |
| IL-2 is a powerful immunoregulatory lymphokine produced by T cells in response to antigenic or mitogenic stimulation. IL-2/IL-2R signaling is required for T cell proliferation and other fundamental functions that are essential for the immune response. IL-2 stimulates growth and differentiation of B cells, NK cells, lymphokine-activated killer cells, monocytes, macrophages and oligodendrocytes. Recombinant Human IL-2 is a 15.5 kDa protein, containing 134 amino acid residues including one intrachain disulfide bond. |
| Data |
| |