| Product | Catalog No. | Specification | Shelf life | Price |
|---|---|---|---|---|
BETAGENE rhIL-15 | GE07.1 | 50μg | 24 months | 2500 |
GE07.2 | 100μg | 3600 |
| Product | CAT. No. | Volumn | Shelf life | Price |
|---|---|---|---|---|
rhIL-15 | GE07.1 | 50μg | 24 months | 2500 |
GE07.2 | 100μg | 3600 |
IL-15 is an immunomodulating cytokine that stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. IL-15 exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. Increased expression of IL-15 has been linked to rheumatoid arthritis, inflammatory bowel disease, and diseases affiliated with retroviruses HIV and HTLV-I. Human IL-15 is biologically active on mouse cells as measured by the dose-dependent stimulation of the proliferation of mouse CTLL cells. Recombinant Human IL-15 is a 12.9 kDa protein consisting of 114 amino acid residues.
储存分类代码 | WGK | 闪点（F） |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
闪点（C) | 个人防护装备 | |
Not Applicable | dust mask type N95 (US), Eyeshields, Gloves | |
Specs
Data
| Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Gene ID | 3600 |
| AA Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Host | E.Coli |
| Molecule Weight | Approximately 12.9 kDa, 114 amino acids |
| Biological Activity | Fully biologically active when compared to standard substance. The ED50 as determined by the dose-dependent stimulation of the proliferation of CTLL-2 cells was found to be ≤ 0.5 ng/mL, corresponding to a specific activity of ≥ 2 x 106 units/mg. |
| Purity | ＞97% by SDS-PAGE or HPLC |
| Formulation | Lyophilized from a 0.2μm filtered solution in PBS pH7.4. |
| Host Cell DNA | < 0.02 ng/μg of protein |
| Host Cell Protein | < 0.05% when tested by ELISA |
| Mycoplasma | Negative |
| Endotoxin (LAL) | < 0.01 EU/μg |
| Sterility | Negative |
| Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Stability&Storage |
For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. At least 24 months from date of receipt, ≤-20℃ as supplied; 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution; 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
| Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
| Description |
IL-15 is an immunomodulating cytokine that stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. IL-15 exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. Increased expression of IL-15 has been linked to rheumatoid arthritis, inflammatory bowel disease, and diseases affiliated with retroviruses HIV and HTLV-I. Human IL-15 is biologically active on mouse cells as measured by the dose-dependent stimulation of the proliferation of mouse CTLL cells. Recombinant Human IL-15 is a 12.9 kDa protein consisting of 114 amino acid residues. |
| Data |
|