Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE rhEGF | GE03.1 | 50μg | 24 months | 420 |
GE03.2 | 100μg | 700 |
Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhEGF | GE03.1 | 50μg | 24 months | 420 |
GE03.2 | 100μg | 700 |
Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. It was originally discovered in the submaxillary glands of mice and in human urine, and then has been found in many human tissues. EGF stimulates the proliferation of various epidermal and epithelial cells, inhibits gastric secretion, and involves in wound healing. Recombinant human EGF is a single non-glycosylated polypeptide chain containing 53 amino acids,there are 3 intramolecular disulfide bonds in the EGF polypeptide chain and the molecular weight of EGF is 6.2kDa.
储存分类代码 | WGK | 闪点(F) |
11 - Combustible Solids | WGK 2 | Not Applicable |
闪点(C) | 个人防护装备 | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 1950 |
AA Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Host | E.Coli |
Molecule Weight | Approximately 6.2 kDa |
Biological Activity | Fully biologically active when compared to standard substance. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1 ng/mL, corresponding to a specific activity of > 1.0 × 106 IU/mg |
Purity | >95% by SDS-PAGE or HPLC |
Formulation | Lyophilized from a 0.2μm filtered solution in PBS pH 7.4. |
Host Cell DNA | < 0.02 ng/μg of protein |
Host Cell Protein | < 0.05% when tested by ELISA |
Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Stability&Storage |
For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. At least 24 months from date of receipt, ≤-20℃ as supplied; 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution; 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
Description |
Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. It was originally discovered in the submaxillary glands of mice and in human urine, and then has been found in many human tissues. EGF stimulates the proliferation of various epidermal and epithelial cells, inhibits gastric secretion, and involves in wound healing. Recombinant human EGF is a single non-glycosylated polypeptide chain containing 53 amino acids,there are 3 intramolecular disulfide bonds in the EGF polypeptide chain and the molecular weight of EGF is 6.2kDa. |
Data |