Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhIGF-1 | GE09.1 | 50μg | 24 months | 450 |
GE09.2 | 100μg | 750 |
Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE rhIGF-1 | GE09.1 | 50μg | 24 months | 450 |
GE09.2 | 100μg | 750 |
The insulin-like growth factors (IGFs) belonged to the insulin gene family, are mitogenic polypeptide growth factors that stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. The IGFs are similar by structure and function to insulin, but have a much higher growth-promoting activity than insulin. The production of IGF-1 is stimulated by growth hormone (GH) and can be retarded by undernutrition, growth hormone insensitivity, lack of growth hormone receptors, or failures of the downstream signaling pathway post GH receptor including SHP2 and STAT5B.
Storage Class Code | WGK | Flash Point(F) |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
Flash Point(C) | Personal Protection | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 3479 |
AA Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Host | E.Coli |
Molecule Weight | Approximately 7.6kDa, a non-glycosylated polypeptide chain containing 70 amino acids |
Biological Activity | Fully biologically active when compared to standard substance. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/mL, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
Purity | >98% by SDS-PAGE or HPLC |
Formulation | Lyophilized from a 0.2μm filtered solution in PBS pH 7.0. |
Host Cell DNA | < 0.02 ng/μg of protein |
Host Cell Protein | < 0.05% when tested by ELISA |
Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Stability&Storage |
For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. At least 24 months from date of receipt, ≤-20℃ as supplied; 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution; 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
Description |
The insulin-like growth factors (IGFs) belonged to the insulin gene family, are mitogenic polypeptide growth factors that stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. The IGFs are similar by structure and function to insulin, but have a much higher growth-promoting activity than insulin. The production of IGF-1 is stimulated by growth hormone (GH) and can be retarded by undernutrition, growth hormone insensitivity, lack of growth hormone receptors, or failures of the downstream signaling pathway post GH receptor including SHP2 and STAT5B. |
Data |