| Product | Catalog No. | Specification | Shelf life | Price |
|---|---|---|---|---|
BETAGENE rhIL-6 | GE15.1 | 20μg | 24 months | 2000 |
GE15.2 | 100μg | 5000 |
| Product | CAT. No. | Volumn | Shelf life | Price |
|---|---|---|---|---|
rhIL-6 | GE15.1 | 20μg | 24 months | 2000 |
GE15.2 | 100μg | 5000 |
IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. It stimulates B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells.
储存分类代码 | WGK | 闪点（F） |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
闪点（C) | 个人防护装备 | |
Not Applicable | dust mask type N95 (US), Eyeshields, Gloves | |
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 3569 |
AA Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Host | E.Coli |
Molecule Weight | Approximately 20.8 kDa, a single non-glycosylated polypeptide chain containing 183 amino acids. |
Biological Activity | Assay 1: The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/mL, corresponding to a specific activity of > 1.0 × 107 Units/mg. Assay 2: The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/mL, corresponding to a specific activity of > 1.25 × 106 Units/mg. |
| Purity | ＞98% by SDS-PAGE or HPLC |
| Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in 20mM PB, 150mM NaCl, pH7.4 |
| Host Cell DNA | < 0.02 ng/μg of protein |
| Host Cell Protein | < 0.05% when tested by ELISA |
| Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
| Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Stability&Storage | For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. 12 months from date of receipt, -20 to -70 °C as supplied. 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL. |
| Description |
| IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. It stimulates B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. |
| Data |
| |