| Product | Catalog No. | Specification | Shelf life | Price |
|---|---|---|---|---|
BETAGENE rhIL-3 | GE14.1 | 10μg | 24 months | 1500 |
GE14.2 | 100μg | 5000 |
| Product | CAT. No. | Volumn | Shelf life | Price |
|---|---|---|---|---|
rhIL-3 | GE14.1 | 10μg | 24 months | 1500 |
GE14.2 | 100μg | 5000 |
IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is a species-specific, variably glycosylated cytokine.
储存分类代码 | WGK | 闪点（F） |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
闪点（C) | 个人防护装备 | |
Not Applicable | dust mask type N95 (US), Eyeshields, Gloves | |
Specs
DATA
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 3562 |
AA Sequence | APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Host | E.Coli |
Molecule Weight | Approximately 15kDa globular protein containing 133 amino acid residues. |
Biological Activity | The ED50 as determined by a cell proliferation assay using human TF-1 cells is ＜0.1 ng/mL, corresponding to a specific activity of ≥ 1.0 × 107 Units/mg. |
| Purity | ＞98% by SDS-PAGE or HPLC |
| Formulation | Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, 150mM NaCl, pH7.4 |
| Host Cell DNA | < 0.02 ng/μg of protein |
| Host Cell Protein | < 0.05% when tested by ELISA |
| Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
| Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Stability&Storage | For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. 12 months from date of receipt, -20 to -70 °C as supplied. 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL |
| Description |
IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is a species-specific, variably glycosylated cytokine. |
| Data |
|